PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G10280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 276aa    MW: 30595.6 Da    PI: 4.8674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G10280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  ORUFI06G10280.1 14 KGPWTAEEDQKLVAFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.36.5e-1771111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +E+ l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  ORUFI06G10280.1  71 SDDEERLVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.227961IPR017930Myb domain
SuperFamilySSF466893.26E-2711108IPR009057Homeodomain-like
SMARTSM007177.3E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.26E-91661No hitNo description
PROSITE profilePS5129427.50362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2463116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
CDDcd001676.79E-1271112No hitNo description
PfamPF002491.1E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVAFLL THGHCCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEERLVID LHAQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHQPLE PPRPPPREQD ATPPPPPPEP PEQQRPPPPP PQEIEESEEE EQEPSPLIEP  180
HEITAPPPAA AAEAATSNCS VSPASVLSPS CSSSASAASA VDVAEWPEPM YMFGMDGIMD  240
VGWNGLISGA GVDVDVDPFD HYYHDASFDD QDVWII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655982.11e-142PREDICTED: myb-related protein 308-like
SwissprotQ50EX62e-84ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0E0PW100.0A0A0E0PW10_ORYRU; Uncharacterized protein
STRINGOB06G19130.11e-141(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-81myb domain protein 20